PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009795565.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family GRAS
Protein Properties Length: 529aa    MW: 59802.9 Da    PI: 6.2933
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009795565.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS242.61.7e-741515282374
            GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                     ++lL  cA a++ g+++++q+lL  l+elas + d+++Rlaa+ ++AL ++l++ +s+ + ++ +++ ++ n++    +l  f+++ P++++ + 
  XP_009795565.1 151 EHLLNPCAAAITVGNMNRVQHLLYVLHELASFTCDANHRLAAHGLRALTHHLSSPGSSSS-SVGVTNFASANHKFFRDSLINFNDINPWFRIPNN 244
                     699**************************************************9666655.456666666667777777777************* PP

            GRAS  97 taNqaIleavege...ervHiiDfdisqGlQWpaLlqaLasRp.egppslRiTgvgspesg.........skeeleetgerLakfAeelgvpfef 178
                     +aN+a+l+ + ++   + +Hi+D+++s+G+QWp+Ll++L+ R+ ++pp +R+T++ +  ++               +  ++L  fA+++++++++
  XP_009795565.1 245 IANSAVLQILGEHdklKNLHILDIGVSHGVQWPTLLEELTRRSgGPPPLVRLTVITPTVENaelggtpfvIGPPGYNFSSQLLAFAKAININLQI 339
                     **********999555667************************55666*******99777688999888878888999***************** PP

            GRAS 179 nvlvakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadh..ns.esFlerflealeyysalfds 270
                     n l    l++l+ + ++ +++E l+ + +++lh+l+   ++ ++ r+e+L+++ksl Pk vvv+e+++d+  ns ++F + f++ +ey + ++ds
  XP_009795565.1 340 NRLDNFPLQNLNSQVINSSEDEILVTCAQFRLHNLH---HNNPDDRTEFLRILKSLDPKGVVVSENNIDCscNScGDFTTTFSRRVEYLWRFLDS 431
                     **8777*****************************9...66666778*******************96664354259****************** PP

            GRAS 271 leaklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvk.sdgyrveeesgslvlgWkd 364
                     +++ +    + r + Er++++ e+ n++++ g++    +e++ekW er++++GF +  ++e+a + a++llrk++ +++ rvee++g++ l Wk+
  XP_009795565.1 432 TSVAY----KGRESEERRMMEGEAANALTNMGEM----NERKEKWCERMRSVGFVKEVFGEDAIDGARALLRKYDsNWEIRVEERDGCVDLWWKG 518
                     *9985....77888888888889**********9....88888********************************9999**************** PP

            GRAS 365 rpLvsvSaWr 374
                     +p+ ++S W+
  XP_009795565.1 519 QPISFCSLWK 528
                     *********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098536.94124507IPR005202Transcription factor GRAS
PfamPF035145.7E-72151528IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042446Biological Processhormone biosynthetic process
GO:2000032Biological Processregulation of secondary shoot formation
Sequence ? help Back to Top
Protein Sequence    Length: 529 aa     Download sequence    Send to blast
MTIDEPEPNS NSDPISEWLD TLSDVPSFLD EPYNYPEDFN FYGDSWWIPP NQDKHIVNHD  60
IIDNNICTSF NYSSPVNAAT STIPPEPIIL DLSKKRKTSG SESDHNPKVS RKNRNRHTNE  120
ADEMKKSTGH KRVTNKSTTN NCSNKEGRWA EHLLNPCAAA ITVGNMNRVQ HLLYVLHELA  180
SFTCDANHRL AAHGLRALTH HLSSPGSSSS SVGVTNFASA NHKFFRDSLI NFNDINPWFR  240
IPNNIANSAV LQILGEHDKL KNLHILDIGV SHGVQWPTLL EELTRRSGGP PPLVRLTVIT  300
PTVENAELGG TPFVIGPPGY NFSSQLLAFA KAININLQIN RLDNFPLQNL NSQVINSSED  360
EILVTCAQFR LHNLHHNNPD DRTEFLRILK SLDPKGVVVS ENNIDCSCNS CGDFTTTFSR  420
RVEYLWRFLD STSVAYKGRE SEERRMMEGE AANALTNMGE MNERKEKWCE RMRSVGFVKE  480
VFGEDAIDGA RALLRKYDSN WEIRVEERDG CVDLWWKGQP ISFCSLWKT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-2018552838375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEF0327360.0EF032736.1 Nicotiana benthamiana nodulation signaling pathway 1-like protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009795565.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
RefseqXP_016435382.10.0PREDICTED: nodulation-signaling pathway 1 protein-like
SwissprotQ4VYC80.0NSP1_MEDTR; Nodulation-signaling pathway 1 protein
TrEMBLA0A076FNG40.0A0A076FNG4_TOBAC; GRAS16 protein
STRINGPGSC0003DMT4000896920.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA49492139
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13840.11e-146GRAS family protein